BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= A9601_13281 putative chaperon-like protein for quinone binding in photosystem II (320 letters) Database: GCA_000760195.1P 1970 sequences; 508,307 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EV06_1440 putative chaperon-like protein Ycf39 for quinone bindi... 473 e-169 EV06_1064 NAD dependent epimerase/dehydratase 54 6e-10 EV06_0969 Short-chain dehydrogenase/reductase (SDR) :Glucose 40 5e-05 EV06_0047 UDP-glucose 4-epimerase 32 0.012 EV06_0034 UDP-glucose 4-epimerase 28 0.23 EV06_1276 Nucleoside-diphosphate-sugar epimerase 28 0.32 EV06_0660 Cell division inhibitor 28 0.36 EV06_0971 Light-dependent protochlorophyllide reductase 27 0.89 D9817bb9ebb98693b45134dd4899038f >EV06_1440 putative chaperon-like protein Ycf39 for quinone binding in Photosystem II Length = 324 Score = 473 bits (1218), Expect = e-169, Method: Compositional matrix adjust. Identities = 222/320 (69%), Positives = 265/320 (82%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 MK L++G TGTLGRQIAK+AI+ G +VRC VR PRKAS+LQEWGCELT+G+LLN D+EY Sbjct: 5 MKALIIGGTGTLGRQIAKKAIDSGIQVRCMVRRPRKASYLQEWGCELTQGDLLNPKDLEY 64 Query: 61 ALQDIEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNVP 120 AL I+ VIDAATSRPDDP+S+YE DW GKLNLF ACES+ VKRV+FLS+L E+FRNVP Sbjct: 65 ALSGIDAVIDAATSRPDDPRSVYETDWQGKLNLFRACESVGVKRVVFLSLLAAEQFRNVP 124 Query: 121 LMDIKFCTEKLLEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMNTQ 180 LMDIK+CTEKLLE+S LD+TI + AAFMQGVIGQFAIPILD+Q VW+SG ++IAYMNTQ Sbjct: 125 LMDIKYCTEKLLEESSLDFTILQGAAFMQGVIGQFAIPILDNQPVWISGNASEIAYMNTQ 184 Query: 181 DMAKVVVAAVNNPKTHRTSLPLVGPKAWDSNEVISLCEKFSEKKAKIFRVSPFLISVTQK 240 DMA VAA+ P+T R S PLVGPK+W S EV+ LCE FS+KKAKI RVSPFLI++ + Sbjct: 185 DMAAFAVAALERPQTIRRSYPLVGPKSWKSEEVVKLCEGFSDKKAKILRVSPFLIAIAKT 244 Query: 241 VVSFFQDSLNVAERLAFAEVTSSGESLDADMSKTYEILELKKEDMTSLESYIKEYYQQIL 300 +VSFFQ SLNVAERL+FA+V+ SG LDA M TY+ +L T+LESYIKEYY IL Sbjct: 245 LVSFFQASLNVAERLSFADVSGSGMKLDAPMEDTYKDFDLDPALTTNLESYIKEYYGVIL 304 Query: 301 KRLREMEADLNIEEKKRLPF 320 KRLREMEADL+ E++K+LPF Sbjct: 305 KRLREMEADLSKEQRKKLPF 324 >EV06_1064 NAD dependent epimerase/dehydratase Length = 230 Score = 54.3 bits (129), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 17/160 (10%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRN----PRKASFLQEWGCELTKGNLLNSS 56 MKI + GA+G G +IA++A++ ++V VR P S C+ + +L NS Sbjct: 1 MKIAVSGASGKTGYRIAEEALKNKNDVSLIVRKDSVIPNSLS-----SCKTIRLSLFNSD 55 Query: 57 DIEYALQDIEVVIDAATSRPD-DPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEK 115 ++ AL+ I+V+I A +R + D +D G N +C+ VKR+I +S L K Sbjct: 56 ELNDALKGIDVLIIATGARANIDLTGPSRVDALGVNNQVESCKKNGVKRIILVSSLCVGK 115 Query: 116 -FRNVPLMDI-----KFCTEKLLEKSDLDYTIFKCAAFMQ 149 F + L + KF K++ S +D+TI + + Sbjct: 116 LFHPLNLFGLILLWKKFGESKVIN-SGIDWTIIRPGGLKE 154 >EV06_0969 Short-chain dehydrogenase/reductase (SDR) :Glucose Length = 239 Score = 39.7 bits (91), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPR--KASFL 40 I++ GA+ +GR IA++A+E+GH + +RNP K S L Sbjct: 8 IIITGASRGIGRSIAEKALEDGHNISIGIRNPEDIKGSIL 47 >EV06_0047 UDP-glucose 4-epimerase Length = 275 Score = 32.3 bits (72), Expect = 0.012, Method: Compositional matrix adjust. Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 10/115 (8%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVR--NPRKASFLQE--WGCELTKGNLLNSS 56 M++ L G TG +G A+ GH++ R + K L+E W +G+L ++ Sbjct: 1 MRVFLTGGTGFVGSHFLNHAVNCGHDITAIKRYSSSPKIKLLKEPVW----KRGSLDSNW 56 Query: 57 DIEYALQD--IEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLS 109 E ++ D I +D + ++ + + LNL+ VKR+I L Sbjct: 57 KKELSVSDVLIHFASHGVLEGSNDWVNCFKTNVEKSLNLWLQAIEAGVKRLIILG 111 >EV06_0034 UDP-glucose 4-epimerase Length = 340 Score = 28.5 bits (62), Expect = 0.23, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 19/27 (70%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEV 27 M+IL+ G+ G +G + ++ IE G++V Sbjct: 1 MRILVTGSAGFIGFHLCQKLIENGNDV 27 >EV06_1276 Nucleoside-diphosphate-sugar epimerase Length = 332 Score = 28.1 bits (61), Expect = 0.32, Method: Compositional matrix adjust. Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Query: 2 KILLVGATGTLGRQIAKQAIEEGH-EVRCFVRNPRKASFL--QEWGCELTKGNLLNSSDI 58 KIL+ GA+G +G+ + ++ E+ ++R+P K S + ++ +L G+L N Sbjct: 5 KILITGASGCVGQYVCNWLLKNTQAELLLWLRDPTKLSAINPKDSRIKLLIGDLRNPEIF 64 Query: 59 EYALQDIEVVIDAATSRPD 77 L V+ AT+ D Sbjct: 65 STYLAQATHVVHTATAWGD 83 >EV06_0660 Cell division inhibitor Length = 311 Score = 27.7 bits (60), Expect = 0.36, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 21/32 (65%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVR 32 M++LL+G +G +G ++ + ++ GH++ R Sbjct: 1 MRLLLLGCSGFIGSELVPKLLKSGHQLTIVSR 32 >EV06_0971 Light-dependent protochlorophyllide reductase Length = 338 Score = 26.6 bits (57), Expect = 0.89, Method: Compositional matrix adjust. Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNL---LNSSDI 58 +IL+ G T +G Q + IE H + RN +FL L K N+ L S + Sbjct: 8 RILITGGTSGIGYQAVLKFIEAKHNLIIPCRNNSSLNFLLN---SLKKDNISIDLIESKV 64 Query: 59 EYALQDI 65 E+ + D+ Sbjct: 65 EFPIVDL 71 Database: GCA_000760195.1P Posted date: Aug 27, 2016 11:15 PM Number of letters in database: 508,307 Number of sequences in database: 1970 Lambda K H 0.319 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1970 Number of Hits to DB: 306,438 Number of extensions: 12257 Number of successful extensions: 54 Number of sequences better than 1.0: 8 Number of HSP's gapped: 53 Number of HSP's successfully gapped: 8 Length of query: 320 Length of database: 508,307 Length adjustment: 77 Effective length of query: 243 Effective length of database: 356,617 Effective search space: 86657931 Effective search space used: 86657931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
16.783572445