BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= A9601_13281 putative chaperon-like protein for quinone binding in photosystem II (320 letters) Database: GCA_000340785.1P 3561 sequences; 1,135,195 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value MYO_119760 ycf39 Ycf39 328 e-111 MYO_115400 ycf39 YCF39 protein 67 7e-14 MYO_127500 hypothetical protein 63 3e-12 MYO_127090 hypothetical protein 43 1e-05 MYO_16700 dfrA dihydroflavonol 4-reductase 42 4e-05 MYO_19400 sulA cell division inhibitor 33 0.013 MYO_13470 galE UDP-glucose-4-epimerase 33 0.022 MYO_115490 rfbB dTDP-glucose 4-6-dehydratase 32 0.047 MYO_121710 hypothetical protein 31 0.059 MYO_18960 hypothetical protein 30 0.12 MYO_17470 aklaviketone reductase 30 0.16 MYO_11870 hypothetical protein 30 0.16 033b61afeb2d33dbc8b10d9d3eca2b29 >MYO_119760 ycf39 Ycf39 Length = 326 Score = 328 bits (840), Expect = e-111, Method: Compositional matrix adjust. Identities = 150/311 (48%), Positives = 220/311 (70%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 M++L+VG TGTLGRQI +QAI++GH V C VR+ RKA+FL+EWG + GN+ + Sbjct: 1 MRVLVVGGTGTLGRQIVRQAIDQGHTVVCLVRSLRKAAFLKEWGATIVGGNICKPETLSP 60 Query: 61 ALQDIEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNVP 120 AL++I+ VIDA+T+R D +I ++DW+GKLNL A + +K+ +F SIL ++ VP Sbjct: 61 ALENIDAVIDASTARATDSLTIRQVDWEGKLNLIRAVQKAGIKKFVFFSILRAAEYPKVP 120 Query: 121 LMDIKFCTEKLLEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMNTQ 180 LMDIK CTEK L +++LDYTI + A FMQG+IGQ+AIPILD+Q+VW +G T IAYMNTQ Sbjct: 121 LMDIKNCTEKFLAQTNLDYTILQLAGFMQGLIGQYAIPILDNQSVWQTGENTPIAYMNTQ 180 Query: 181 DMAKVVVAAVNNPKTHRTSLPLVGPKAWDSNEVISLCEKFSEKKAKIFRVSPFLISVTQK 240 D+AK V AV R + P+VG +AW + E+I LCE+ S A+I +V ++ + Sbjct: 181 DVAKFAVRAVELDSVARKTYPVVGSRAWGATEIIQLCERMSGNNARISQVPMAVLRFMRS 240 Query: 241 VVSFFQDSLNVAERLAFAEVTSSGESLDADMSKTYEILELKKEDMTSLESYIKEYYQQIL 300 FFQ + N ++RLAF+EV +SG++L ADM+ YE L ++ T+LESY++EY+ +I+ Sbjct: 241 FTRFFQWTYNASDRLAFSEVLASGKALTADMAPVYEQFGLDPKETTTLESYLQEYFGRII 300 Query: 301 KRLREMEADLN 311 K+L+E++ ++N Sbjct: 301 KKLKELDYEVN 311 >MYO_115400 ycf39 YCF39 protein Length = 219 Score = 66.6 bits (161), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 44/153 (28%), Positives = 78/153 (50%), Gaps = 6/153 (3%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 MK+L++GATG G+++ + VR VRN A + G E+ G+LL I+ Sbjct: 1 MKVLVIGATGETGKRVVNTLTDRQIAVRALVRNYDSAKAVLPPGTEIMVGDLLEPETIKA 60 Query: 61 ALQDIEVVIDAATSRPD-DPKSIYEIDWDGKLNLFNACESLNVKRVIFLSIL-LTEKFRN 118 A+ VVI+AA +RP D +++D+ G NL + ++ +++++ +S L ++ F Sbjct: 61 AIAGCTVVINAAGARPSADLTGPFKVDYLGTRNLVDIAKANGIEQLVLVSSLCVSNLFHP 120 Query: 119 VPLMDI----KFCTEKLLEKSDLDYTIFKCAAF 147 + L + K E L +S + YTI + Sbjct: 121 LNLFGLILVWKQWGENYLRQSGVPYTIVRPGGL 153 >MYO_127500 hypothetical protein Length = 287 Score = 62.8 bits (151), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 51/214 (23%), Positives = 95/214 (44%), Gaps = 13/214 (6%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEYA 61 KIL+ GATG+ G +I K+ + +VR VR+ +A + E+ +GN + A Sbjct: 4 KILVTGATGSNGTEIVKRLAAKNVQVRAMVRDFDRAKKIAFPNVEVVEGNFDRPETLLEA 63 Query: 62 LQDIE--VVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNV 119 L +++ ++ +T R + +L +A VK ++ LS + V Sbjct: 64 LAEVDRAFLLTNSTERAEAQ----------QLAFVDAARQNGVKHIVKLSQFAADAHSPV 113 Query: 120 PLMDIKFCTEKLLEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMNT 179 + E ++ S + YT + FMQG++ F I A + + + K++ ++ Sbjct: 114 RFLRYHAAVEAAIQGSGMTYTFLRPNLFMQGLL-NFQSTITSQNAFYAAISDAKVSVVDV 172 Query: 180 QDMAKVVVAAVNNPKTHRTSLPLVGPKAWDSNEV 213 +D+A V V A+ + L GP+A E+ Sbjct: 173 RDIADVAVVALTETEHEGKIYNLTGPQALTHAEM 206 >MYO_127090 hypothetical protein Length = 448 Score = 42.7 bits (99), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRN-PRKASFLQEW 43 IL+VGATG +G+++ K I+ G EVR VR+ PR Q W Sbjct: 2 ILVVGATGGVGKRVVKLLIDGGQEVRVLVRDVPRAKKLFQAW 43 >MYO_16700 dfrA dihydroflavonol 4-reductase Length = 343 Score = 41.6 bits (96), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 4/109 (3%) Query: 4 LLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEYALQ 63 + G TG +G + + +E+G++VR VR + LQ + G+ LN D+ +Q Sbjct: 14 FVTGGTGFVGANLVRHLLEQGYQVRALVRASSRPDNLQNLPIDWVVGD-LNDGDLHQQMQ 72 Query: 64 DIEVVIDAATSRP---DDPKSIYEIDWDGKLNLFNACESLNVKRVIFLS 109 + + A D +++Y + G N+ + ++R ++ S Sbjct: 73 GCQGLFHVAAHYSLWQKDREALYRSNVLGTRNILACAQKAGIERTVYTS 121 >MYO_19400 sulA cell division inhibitor Length = 339 Score = 33.5 bits (75), Expect = 0.013, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFL 40 MKI+L GATG +G + ++GHE+ VR+ KA L Sbjct: 33 MKIILTGATGFVGCSLVPLLHQQGHELTLLVRSVSKAQRL 72 >MYO_13470 galE UDP-glucose-4-epimerase Length = 340 Score = 32.7 bits (73), Expect = 0.022, Method: Compositional matrix adjust. Identities = 30/119 (25%), Positives = 50/119 (42%), Gaps = 16/119 (13%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEV----RCFVRNPRKASFLQEWGCELTKGNLLNSSD 57 KIL+ G G +G + +Q E G+ + C P + Q L G+L ++ Sbjct: 8 KILVTGGAGYIGSSVVRQLGEAGYSIVVYDNCSTGFPSSILYGQ-----LVIGDLADTER 62 Query: 58 IEYALQDIEV--VIDAATSR--PD---DPKSIYEIDWDGKLNLFNACESLNVKRVIFLS 109 + + E+ V+ A S P+ P + Y + L+L C+ V R+IF S Sbjct: 63 LHQVFHEHEILAVMHFAGSLIVPESLIHPLNYYANNTSNTLSLIRCCQIFGVNRLIFSS 121 >MYO_115490 rfbB dTDP-glucose 4-6-dehydratase Length = 328 Score = 31.6 bits (70), Expect = 0.047, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCF 30 M+IL+ G G +G + + + +GHEV C Sbjct: 20 MRILVTGGAGFIGSHLIDRLMAQGHEVLCL 49 >MYO_121710 hypothetical protein Length = 226 Score = 31.2 bits (69), Expect = 0.059, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 4 LLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQE-WGCELTKGNLLNSS 56 +L+G G++G +AK ++ GH V +P + +E G +G+ +N+S Sbjct: 3 ILIGGMGSMGSNLAKNLLKMGHTVAAVDTDPLACQYAREKIGVMAFEGSAVNTS 56 >MYO_18960 hypothetical protein Length = 311 Score = 30.4 bits (67), Expect = 0.12, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPR 35 M+IL++G T +G + + + +GHEV F R R Sbjct: 1 MRILIMGGTRFIGIHLCRVLVAQGHEVVLFNRGNR 35 >MYO_17470 aklaviketone reductase Length = 210 Score = 29.6 bits (65), Expect = 0.16, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEV 27 M+IL++GATGT+G+ I +++ HEV Sbjct: 15 MRILIIGATGTIGKAIVT-SLQGKHEV 40 >MYO_11870 hypothetical protein Length = 613 Score = 30.4 bits (67), Expect = 0.16, Method: Compositional matrix adjust. Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 10/87 (11%) Query: 233 FLISVTQKVVSFFQDSLNVAERL---AFAEVTSSGESLDADMSKTYEILELKKEDMTSLE 289 FL+S Q S L +A+RL A VT+ G +++ + + E + L Sbjct: 247 FLVSKVQDTSSL----LGIAQRLMKPVLAPVTAGGRPFQPEITYGVALYPVDGEQVNDLI 302 Query: 290 SYIKEYYQQILKRLRE---MEADLNIE 313 +I+E QQ+L + EAD +IE Sbjct: 303 GHIRENLQQLLPQPTNPGSGEADDHIE 329 Database: GCA_000340785.1P Posted date: Aug 27, 2016 10:56 PM Number of letters in database: 1,135,195 Number of sequences in database: 3561 Lambda K H 0.319 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3561 Number of Hits to DB: 655,077 Number of extensions: 25190 Number of successful extensions: 80 Number of sequences better than 1.0: 14 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 14 Length of query: 320 Length of database: 1,135,195 Length adjustment: 83 Effective length of query: 237 Effective length of database: 839,632 Effective search space: 198992784 Effective search space used: 198992784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
0.447658926