BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= A9601_13281 putative chaperon-like protein for quinone binding in photosystem II (320 letters) Database: GCA_000175855.1P 3007 sequences; 904,229 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CRD_00979 3-beta hydroxysteroid dehydrogenase/isomerase 318 e-108 CRD_03051 3-beta hydroxysteroid dehydrogenase/isomerase 69 5e-15 CRD_00181 NAD-dependent epimerase/dehydratase 47 4e-07 CRD_00773 conserved hypothetical protein 41 6e-05 CRD_02108 3-beta hydroxysteroid dehydrogenase/isomerase 37 8e-04 CRD_00146 UDP-glucose 4-epimerase 31 0.033 CRD_00444 Serine/threonine protein kinase 30 0.14 CRD_01646 groEL Chaperonin Cpn60/TCP-1 30 0.15 CRD_02598 3-beta hydroxysteroid dehydrogenase/isomerase 29 0.23 CRD_01908 conserved hypothetical protein 29 0.29 CRD_02623 conserved hypothetical protein 29 0.35 D6e44cc72a7046c5db9b8da17fd3c4e7 >CRD_00979 3-beta hydroxysteroid dehydrogenase/isomerase Length = 332 Score = 318 bits (815), Expect = e-108, Method: Compositional matrix adjust. Identities = 145/307 (47%), Positives = 221/307 (71%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 M +L+VGATGTLGRQ+ ++A++EG++VRC VR+ +KA+FL+EWG EL KG+L + Sbjct: 1 MTLLVVGATGTLGRQVVRRAVDEGYKVRCLVRSLKKAAFLKEWGAELVKGDLCYPETLVG 60 Query: 61 ALQDIEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNVP 120 AL+ + VIDA+TSR D +I ++DW+GK+ L A +S ++R IF SIL +K+ NVP Sbjct: 61 ALEGVTQVIDASTSRATDSLTIKQVDWEGKVALIQAAKSAGIERFIFFSILDADKYPNVP 120 Query: 121 LMDIKFCTEKLLEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMNTQ 180 LM+IK CTE + +S L+YTI + A FMQG+IGQ+ IPIL++Q VW++G + +AYM+T Sbjct: 121 LMEIKRCTELFIVESGLNYTILRLAGFMQGLIGQYGIPILENQPVWVTGESSPVAYMDTL 180 Query: 181 DMAKVVVAAVNNPKTHRTSLPLVGPKAWDSNEVISLCEKFSEKKAKIFRVSPFLISVTQK 240 D+AK + A+ P+T + + PLVG +AW + E+I +CE+ S K AKI R+ L+ Q Sbjct: 181 DIAKFAIRALTVPETEKQTFPLVGTRAWSAEEIIDICERLSGKDAKITRMPLGLLRGVQG 240 Query: 241 VVSFFQDSLNVAERLAFAEVTSSGESLDADMSKTYEILELKKEDMTSLESYIKEYYQQIL 300 ++ FFQ NVA+RLAF+EV +SG+ L+A M + Y + L K+ T++E Y++EY+ +I+ Sbjct: 241 LLRFFQWGWNVADRLAFSEVLASGKPLNASMDEVYTVFGLDKQQTTTVEIYLQEYFSRIM 300 Query: 301 KRLREME 307 K+L+E++ Sbjct: 301 KKLKELD 307 >CRD_03051 3-beta hydroxysteroid dehydrogenase/isomerase Length = 208 Score = 69.3 bits (168), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 46/153 (30%), Positives = 76/153 (49%), Gaps = 6/153 (3%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 MK + GATG G++I ++ + VR VR+ +KA L EL G++L + Sbjct: 1 MKAFVAGATGQTGQRIVEELVSRNIPVRALVRDEQKARNLLPSQVELIVGDILQPESLIA 60 Query: 61 ALQDIEVVIDAATSRPD-DPKSIYEIDWDGKLNLFNACESLNVKRVIFLSIL-LTEKFRN 118 AL D VV+ A +RP DP Y++D+ G NL A + ++ + +S L +++ F Sbjct: 61 ALGDSTVVLCATGARPSFDPTGPYQVDFQGTKNLVKAAQDRKIQHFVLVSSLCVSQLFHP 120 Query: 119 VPLMDI----KFCTEKLLEKSDLDYTIFKCAAF 147 + L + K E+ + KS + YTI + Sbjct: 121 LNLFWLILVWKKQAEEFIRKSGISYTIVRPGGL 153 >CRD_00181 NAD-dependent epimerase/dehydratase Length = 332 Score = 47.4 bits (111), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 26/142 (18%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWG------------CELTK 49 KIL+ GA G +G + + + EG++VR FV + WG E+ Sbjct: 3 KILVTGADGFIGSHLTEALVREGYQVRAFVL----YNSFNSWGWLDHSPREVIDNLEIFS 58 Query: 50 GNLLNSSDIEYALQDIEVVIDAAT--SRP---DDPKSIYEIDWDGKLNLFNACESLNVKR 104 G++ + +++ A+ +VV+ A + P P + E + G LN+ A S+ V++ Sbjct: 59 GDIRDPYNVKSAMNGCDVVLHLAALIAIPYSYHSPATYVETNITGTLNVLQAARSVGVEK 118 Query: 105 VIFLS---ILLTEKFRNVPLMD 123 V+ S + T KF VP+ + Sbjct: 119 VVHTSTSEVYGTAKF--VPITE 138 >CRD_00773 conserved hypothetical protein Length = 498 Score = 40.8 bits (94), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 26/35 (74%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKA 37 IL+ GATG +G+++ K+ + +G+ VRC VR+ KA Sbjct: 54 ILVAGATGGVGKRVVKKLLTQGYRVRCLVRDIEKA 88 >CRD_02108 3-beta hydroxysteroid dehydrogenase/isomerase Length = 340 Score = 37.0 bits (84), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 10/117 (8%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 MKIL+ G G LG + I +GH+V K +L G E+T LN Sbjct: 1 MKILVTGTEGYLGSLLPPLLIAKGHKVIGVDTGFYKVGWLYN-GTEVTV-KTLNKDIRNI 58 Query: 61 ALQD---IEVVIDAATSRPDD-----PKSIYEIDWDGKLNLFNACESLNVKRVIFLS 109 L+D ++ ++ A D P Y+I+ G + L N +++ V+R +++S Sbjct: 59 TLEDLAGVDAIVHKAELSNDPTGQLAPHITYDINHLGSVRLANLAKTMGVRRFVYMS 115 >CRD_00146 UDP-glucose 4-epimerase Length = 122 Score = 30.8 bits (68), Expect = 0.033, Method: Compositional matrix adjust. Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 22/120 (18%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEV----RCFVRNPRKASFLQEWGCELTKGNLLNSSD 57 KIL+ G G +G + Q E G+++ C P S L EL G+L +D Sbjct: 4 KILVTGGAGYIGSHVVLQLAESGYDIVVYDNCSTGTPE--SVLHG---ELVVGDL---AD 55 Query: 58 IE-----YALQDIEVVIDAATSR--PD---DPKSIYEIDWDGKLNLFNACESLNVKRVIF 107 ++ ++ V+ A S P+ P Y + LNL C + V + +F Sbjct: 56 VDRLYQIFSQHKFSAVLHFAASLVVPESVAHPLDYYANNTRNTLNLLRCCSVMGVNQFVF 115 >CRD_00444 Serine/threonine protein kinase Length = 374 Score = 30.0 bits (66), Expect = 0.14, Method: Compositional matrix adjust. Identities = 11/47 (23%), Positives = 25/47 (53%) Query: 132 LEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMN 178 +++ ++DY ++ QG + +F + +L + W G+ +I Y N Sbjct: 182 VKRGEVDYFAYEEGQDSQGRVAEFNVAVLSVEYKWQLGSTYQIKYNN 228 >CRD_01646 groEL Chaperonin Cpn60/TCP-1 Length = 545 Score = 30.0 bits (66), Expect = 0.15, Method: Compositional matrix adjust. Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 10/128 (7%) Query: 137 LDYTIFKCAAFMQGVIGQFAIPILDSQAVWM-----SGTPTKIAYMNTQDMAKV---VVA 188 L I K AF+ I + A P+ DS+A+ +G ++ M + M KV V Sbjct: 115 LKRGIDKATAFLVDKIAEHARPVEDSKAIAQVGSISAGNDEEVGQMIAEAMDKVGKEGVI 174 Query: 189 AVNNPKTHRTSLPLVGPKAWDSNEVISLCEKFSEKKAKIFRVSPFLISVTQKVVSFFQDS 248 ++ K+ T L + +D + +E+ +F P+++ +T K ++ QD Sbjct: 175 SLEEGKSMTTELEITEGMRFDKGYISPYFATDAERMEAVFD-DPYIL-LTDKKIALVQDL 232 Query: 249 LNVAERLA 256 + V E++A Sbjct: 233 VPVLEQVA 240 >CRD_02598 3-beta hydroxysteroid dehydrogenase/isomerase Length = 314 Score = 29.3 bits (64), Expect = 0.23, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRN 33 M+IL++G T +G + + I+ GHEV F R Sbjct: 1 MRILVIGGTRFIGVYLTQLLIKAGHEVVLFNRG 33 >CRD_01908 conserved hypothetical protein Length = 416 Score = 28.9 bits (63), Expect = 0.29, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKAS 38 I + GA+G+LG+ + Q I++ +V NP S Sbjct: 184 IAITGASGSLGKALTTQLIKQNAKVVALTTNPENIS 219 >CRD_02623 conserved hypothetical protein Length = 307 Score = 28.9 bits (63), Expect = 0.35, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKAS 38 MK+ + GATG +G ++ + + G ++ RNP +++ Sbjct: 1 MKVAVTGATGFVGSRLVQCLHDRGEKILVLSRNPTRSA 38 Database: GCA_000175855.1P Posted date: Aug 27, 2016 10:40 PM Number of letters in database: 904,229 Number of sequences in database: 3007 Lambda K H 0.319 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3007 Number of Hits to DB: 530,753 Number of extensions: 20729 Number of successful extensions: 76 Number of sequences better than 1.0: 11 Number of HSP's gapped: 75 Number of HSP's successfully gapped: 11 Length of query: 320 Length of database: 904,229 Length adjustment: 81 Effective length of query: 239 Effective length of database: 660,662 Effective search space: 157898218 Effective search space used: 157898218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
0.410885275