BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= A9601_13281 putative chaperon-like protein for quinone binding in photosystem II (320 letters) Database: GCA_000012505.1P 2304 sequences; 665,835 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Syncc9902_0675 putative chaperon-like protein for quinone bindin... 445 e-158 Syncc9902_1374 conserved hypothetical protein 59 4e-11 Syncc9902_0956 conserved hypothetical protein 38 3e-04 Syncc9902_0101 capsular polysaccharide biosynthesis protein 35 0.002 Syncc9902_1213 putative short-chain dehydrogenase family protein 31 0.050 Syncc9902_0776 possible nucleotide sugar epimerase 30 0.068 Syncc9902_0330 conserved hypothetical protein 29 0.22 Syncc9902_1634 conserved hypothetical protein 28 0.41 Syncc9902_1216 NADPH-protochlorophyllide oxidoreductase / chloro... 28 0.47 7fd08440e0365dc5055cbe08884b87b7 >Syncc9902_0675 putative chaperon-like protein for quinone binding in photosystem II Length = 320 Score = 445 bits (1144), Expect = e-158, Method: Compositional matrix adjust. Identities = 198/320 (61%), Positives = 254/320 (79%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEY 60 M++L+VG TGTLGRQIA++A++ GH+VRC VR PRKA+FLQEWGCELT+G+LL ++Y Sbjct: 1 MQVLVVGGTGTLGRQIARRALDSGHQVRCMVRTPRKAAFLQEWGCELTRGDLLEPDSLDY 60 Query: 61 ALQDIEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNVP 120 AL ++ VIDAATSRP DP+SIYE DWDGKLNL AC+ NVKR +FLS+L ++R+VP Sbjct: 61 ALDGVDAVIDAATSRPSDPQSIYESDWDGKLNLLKACDRANVKRFVFLSLLGAHRYRDVP 120 Query: 121 LMDIKFCTEKLLEKSDLDYTIFKCAAFMQGVIGQFAIPILDSQAVWMSGTPTKIAYMNTQ 180 LMDIK CTE LLE SD DYTI + AAFMQGVI QFAIP+L+SQ VW+SG+PT IAYMNTQ Sbjct: 121 LMDIKACTENLLEASDFDYTILQGAAFMQGVISQFAIPVLESQTVWVSGSPTAIAYMNTQ 180 Query: 181 DMAKVVVAAVNNPKTHRTSLPLVGPKAWDSNEVISLCEKFSEKKAKIFRVSPFLISVTQK 240 DMA+ VAA+ P+T R + P+VGPK W++ +++ LCE+ S+K A++FRV P LI + Q Sbjct: 181 DMARFAVAALERPETVRGTFPVVGPKPWNTGQLVQLCERCSDKTARVFRVQPILIKLMQG 240 Query: 241 VVSFFQDSLNVAERLAFAEVTSSGESLDADMSKTYEILELKKEDMTSLESYIKEYYQQIL 300 V SFF+ ++NVAERLAFAEVT G++LDA M +Y L + + T +ESYI+EYY IL Sbjct: 241 VASFFEPAVNVAERLAFAEVTGGGQALDAPMKSSYAAFGLDEAETTDMESYIREYYDTIL 300 Query: 301 KRLREMEADLNIEEKKRLPF 320 K+LREMEADL+ + KK+LPF Sbjct: 301 KKLREMEADLDKDAKKKLPF 320 >Syncc9902_1374 conserved hypothetical protein Length = 346 Score = 59.3 bits (142), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 49/220 (22%), Positives = 97/220 (44%), Gaps = 19/220 (8%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEW--------GCELTKGNL 52 +++++ GATG +GR + K+ ++ G++V F R Q G E+ G++ Sbjct: 19 IRVVVFGATGYIGRFVVKELVKRGYQVVAFCRERSGVGGRQSQDQAVADFPGAEVRFGDV 78 Query: 53 --LNSSDIEYALQDIEVVIDAATSRPDDPKSIYEIDWDGKLNLFNACESLNVKRVIFLSI 110 ++S + Q ++VV+ SR + + ID LN + V + LS Sbjct: 79 TDVDSLNQNAFQQPVDVVVSCLASRTGGGQDSWAIDHQASLNTYTEGLKAGVAHYVLLSA 138 Query: 111 LLTEKFRNVPLMDI---KFCTEKLLEK-SDLDYTIFKCAAFMQGVIGQF-AIPILDSQAV 165 + +K PL++ K E L+ +++ Y+I + AF + + GQ + + Sbjct: 139 ICVQK----PLLEFQKAKLAFETALQADTEMSYSIVRPTAFFKSLGGQVESCRKGGPYVM 194 Query: 166 WMSGTPTKIAYMNTQDMAKVVVAAVNNPKTHRTSLPLVGP 205 + GT ++ D+A + + +P+ LP+ GP Sbjct: 195 FGGGTLASCKPISESDLAAFMADCITDPEKRNQVLPIGGP 234 >Syncc9902_0956 conserved hypothetical protein Length = 224 Score = 37.7 bits (86), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 9/148 (6%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIEYAL 62 + + GA+G G +IA++ + G + R +R A CE + ++ N ++ AL Sbjct: 5 VAVSGASGKTGYRIAEELLAAGVQPRLLLRR-ESAVPASLSNCEQVRLSIENDCALDQAL 63 Query: 63 QDIEVVIDAATSRPD-DPKSIYEIDWDGKLNLFNACESLNVKRVIFLSILLTEKFRNVPL 121 E +I A +RP D +D G +C+ +NV RV+ +S L ++R+ PL Sbjct: 64 LGAEALIIATGARPSIDLSGPMRVDAWGVKRQIASCQRVNVNRVVLVSSLCAGRWRH-PL 122 Query: 122 ------MDIKFCTEKLLEKSDLDYTIFK 143 + K E+ LE+S L++T+ + Sbjct: 123 NLFGLILVWKRIGERALERSGLNWTVVR 150 >Syncc9902_0101 capsular polysaccharide biosynthesis protein Length = 339 Score = 35.0 bits (79), Expect = 0.002, Method: Compositional matrix adjust. Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 24/150 (16%) Query: 2 KILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEWGCELTK------------ 49 KILL G TG+ G+ K+ I + +V V R L++W EL + Sbjct: 7 KILLTGGTGSFGKAFIKETITKYQDVERLVIYSRDE--LKQW--ELQQIYPEKQYPQIRF 62 Query: 50 --GNLLNSSDIEYALQDIEVVIDAAT-----SRPDDPKSIYEIDWDGKLNLFNACESLNV 102 G++ + + + AL+ I+ V+ AA + +P + + G NL AC V Sbjct: 63 FLGDVRDENRLRRALEGIDTVVHAAALKQVPAAEYNPFEFVKTNIIGANNLIQACLDTEV 122 Query: 103 KRVIFLSILLTEKFRNVPLMDIKFCTEKLL 132 ++ LS N+ K C++KL Sbjct: 123 SNIVALSTDKAAAPINL-YGATKLCSDKLF 151 >Syncc9902_1213 putative short-chain dehydrogenase family protein Length = 231 Score = 30.8 bits (68), Expect = 0.050, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 23/32 (71%) Query: 3 ILLVGATGTLGRQIAKQAIEEGHEVRCFVRNP 34 IL+ G++ +GR IA++ + +G+++ VRNP Sbjct: 5 ILVSGSSRGIGRSIAERLLSDGYQLSLGVRNP 36 >Syncc9902_0776 possible nucleotide sugar epimerase Length = 306 Score = 30.4 bits (67), Expect = 0.068, Method: Compositional matrix adjust. Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 11/86 (12%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVR--NPRKASFLQEWGCELTKGNLLNSSDI 58 M+IL++G T +G+ + + + +GH + F R NP A G E G+ + + Sbjct: 1 MQILVMGGTRFVGKPLVARLMAQGHALTLFTRGKNPVPA------GVEHITGDRSSDEGL 54 Query: 59 EYALQD--IEVVIDAATSRPDDPKSI 82 ALQ +V++D++ DD + + Sbjct: 55 S-ALQGRAFDVIVDSSGRTLDDSRRV 79 >Syncc9902_0330 conserved hypothetical protein Length = 309 Score = 28.9 bits (63), Expect = 0.22, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRN 33 M++LL+G TG +GR++ +E H++ R Sbjct: 1 MRLLLLGCTGFVGRELVPALLEADHQLTLVSRR 33 >Syncc9902_1634 conserved hypothetical protein Length = 346 Score = 28.1 bits (61), Expect = 0.41, Method: Compositional matrix adjust. Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 13/87 (14%) Query: 2 KILLVGATGTLGRQIAK--QAIEEGHEVRCFVRNPRKASFLQEWGCELTKGNLLNSSDIE 59 K+ +VGATG +G + + A E+ R P+ + LQ EL G +L SD Sbjct: 155 KVAVVGATGDIGSAVCRWLTARTNVGELLLVARQPQPLADLQ---AELGGGRILALSD-- 209 Query: 60 YALQDIEVVIDAATSRPDDPKSIYEID 86 AL + +VV+ A+ P+++ EID Sbjct: 210 -ALSEADVVVWVASM----PRTL-EID 230 >Syncc9902_1216 NADPH-protochlorophyllide oxidoreductase / chlorophyll synthase Length = 322 Score = 27.7 bits (60), Expect = 0.47, Method: Compositional matrix adjust. Identities = 12/43 (27%), Positives = 21/43 (48%) Query: 1 MKILLVGATGTLGRQIAKQAIEEGHEVRCFVRNPRKASFLQEW 43 ++IL+ GA +G A+ E GH + R+ +A +W Sbjct: 7 LRILMTGANSGIGEAAARHLQESGHALTVVCRSRERAEQSLDW 49 Database: GCA_000012505.1P Posted date: Aug 27, 2016 11:01 PM Number of letters in database: 665,835 Number of sequences in database: 2304 Lambda K H 0.319 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2304 Number of Hits to DB: 367,693 Number of extensions: 13336 Number of successful extensions: 49 Number of sequences better than 1.0: 10 Number of HSP's gapped: 47 Number of HSP's successfully gapped: 10 Length of query: 320 Length of database: 665,835 Length adjustment: 79 Effective length of query: 241 Effective length of database: 483,819 Effective search space: 116600379 Effective search space used: 116600379 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
9.814429195