BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Tery_3440 phosphofructokinase (63 letters) Database: GCA_000316665.1P 6644 sequences; 2,270,700 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Riv7116_5332 L-threonine ammonia-lyase 26 0.38 Fa7424def4491542019675af0ee3d1d7 >Riv7116_5332 L-threonine ammonia-lyase Length = 503 Score = 25.8 bits (55), Expect = 0.38, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 21 ILIPEIPDKIDNICNYISKRSNLDKNYSLIVLAEA 55 + IPE P + C I KR+ + NY + EA Sbjct: 333 VTIPEKPGSLHKFCECIGKRNLTEFNYRIASEKEA 367 Database: GCA_000316665.1P Posted date: Aug 27, 2016 11:12 PM Number of letters in database: 2,270,700 Number of sequences in database: 6644 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 6644 Number of Hits to DB: 272,660 Number of extensions: 8312 Number of successful extensions: 25 Number of sequences better than 1.0: 1 Number of HSP's gapped: 25 Number of HSP's successfully gapped: 1 Length of query: 63 Length of database: 2,270,700 Length adjustment: 35 Effective length of query: 28 Effective length of database: 2,038,160 Effective search space: 57068480 Effective search space used: 57068480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
0.433085313