BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Tery_3440 phosphofructokinase (63 letters) Database: GCA_000176895.2P 5951 sequences; 1,636,729 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ARTHRO_1430009 pfkA1 6-phosphofructokinase I 64 3e-14 ARTHRO_1070007 pfkA2 6-phosphofructokinase I 43 7e-07 ARTHRO_260011 ilvA Threonine dehydratase biosynthetic 26 0.18 F4713181179a2f406856234ecfa5caf9 >ARTHRO_1430009 pfkA1 6-phosphofructokinase I Length = 360 Score = 63.5 bits (153), Expect = 3e-14, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 39/58 (67%) Query: 1 MCGDAIHIPLNAGFASSTDMILIPEIPDKIDNICNYISKRSNLDKNYSLIVLAEAVRT 58 M DA HI L+AG A D+ILIPEIP +D+IC I + KNY L+++AEAVRT Sbjct: 184 MGRDAGHIALHAGIAGGADVILIPEIPYSLDSICQKIEDLQHQGKNYCLVIVAEAVRT 241 >ARTHRO_1070007 pfkA2 6-phosphofructokinase I Length = 384 Score = 42.7 bits (99), Expect = 7e-07, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 7 HIPLNAGFASSTDMILIPEIPDKIDNICNYISKRSNL-DKNYSLIVLAEAVRTES 60 H+ L++G D ILIPEI + +C I + NL ++ ++++V+AE +T S Sbjct: 183 HLALHSGIVGGADAILIPEIRYSVSGLCKRIQQLRNLWERKFAIVVVAEGAKTTS 237 >ARTHRO_260011 ilvA Threonine dehydratase biosynthetic Length = 507 Score = 26.2 bits (56), Expect = 0.18, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 21 ILIPEIPDKIDNICNYISKRSNLDKNYSLIVLAEA 55 + IPE P + CN + KR+ + NY + EA Sbjct: 337 VTIPEQPGSLRKFCNCLGKRNLTEFNYRIADEKEA 371 Database: GCA_000176895.2P Posted date: Aug 27, 2016 11:22 PM Number of letters in database: 1,636,729 Number of sequences in database: 5951 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 5951 Number of Hits to DB: 192,315 Number of extensions: 5617 Number of successful extensions: 13 Number of sequences better than 1.0: 3 Number of HSP's gapped: 13 Number of HSP's successfully gapped: 3 Length of query: 63 Length of database: 1,636,729 Length adjustment: 35 Effective length of query: 28 Effective length of database: 1,428,444 Effective search space: 39996432 Effective search space used: 39996432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
0.427738013