BLASTP 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Tery_3440 phosphofructokinase (63 letters) Database: GCA_000021825.1P 5710 sequences; 1,769,808 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PCC7424_2934 6-phosphofructokinase 66 3e-15 PCC7424_1263 6-phosphofructokinase 42 1e-06 74b6c67058ca7514d81b1f7e3895916a >PCC7424_2934 6-phosphofructokinase Length = 360 Score = 66.2 bits (160), Expect = 3e-15, Method: Composition-based stats. Identities = 30/59 (50%), Positives = 43/59 (72%) Query: 1 MCGDAIHIPLNAGFASSTDMILIPEIPDKIDNICNYISKRSNLDKNYSLIVLAEAVRTE 59 M DA HI L+AG A D+ILIPEIP K++N+C +I KR + K++ L++++EAV TE Sbjct: 184 MGRDAGHIALSAGIAGGADIILIPEIPYKLENVCRHIKKRQDRGKHFCLVIVSEAVCTE 242 >PCC7424_1263 6-phosphofructokinase Length = 403 Score = 42.0 bits (97), Expect = 1e-06, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Query: 1 MCGDAIHIPLNAGFASSTDMILIPE-IPDKIDNI----CNYISKRSNLDKNYSLIVLAEA 55 M DA H+ L+AG A D+ILIPE +P D + C ++ + + ++LIVL+E Sbjct: 189 MGRDAGHLALHAGIAGGADVILIPELVPHLSDQVVEGCCRQMADIRSTGRQFALIVLSEG 248 Query: 56 VRTESDTR 63 V+ +++ + Sbjct: 249 VKNDNNGK 256 Database: GCA_000021825.1P Posted date: Aug 27, 2016 11:13 PM Number of letters in database: 1,769,808 Number of sequences in database: 5710 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 5710 Number of Hits to DB: 206,338 Number of extensions: 6081 Number of successful extensions: 11 Number of sequences better than 1.0: 3 Number of HSP's gapped: 11 Number of HSP's successfully gapped: 3 Length of query: 63 Length of database: 1,769,808 Length adjustment: 35 Effective length of query: 28 Effective length of database: 1,569,958 Effective search space: 43958824 Effective search space used: 43958824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
14.857714168